PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00138649001
Common NameGSBRNA2T00138649001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 182aa    MW: 20472.3 Da    PI: 7.0823
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00138649001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.13.5e-3971061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC++ Cv+apyfp ++++++a++hk+FGas+v k+l++l++++r+da++slvyeA+  + dPv+G+ +++ +lq+ql+ l
  GSBRNA2T00138649001   7 PCAACKYLRRKCTQACVFAPYFPPNKQEDYAAIHKVFGASQVAKILNDLHPSQRQDAVTSLVYEAQTLLLDPVHGCSRHVYNLQNQLKDL 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +l+ +++e
  GSBRNA2T00138649001  97 QDQLQIARNE 106
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.2746107IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-397104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MEKMSMPCAA CKYLRRKCTQ ACVFAPYFPP NKQEDYAAIH KVFGASQVAK ILNDLHPSQR  60
QDAVTSLVYE AQTLLLDPVH GCSRHVYNLQ NQLKDLQDQL QIARNELVSY NNIIPSLDLP  120
PPITYQQNHQ NPMLMPVVSN YGGPLTSEQL REEAHRVESE RSAQVPQMQP NAAPSKRDDC  180
P*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00138649001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647597.11e-130PREDICTED: LOB domain-containing protein 28-like
SwissprotQ9SCS44e-59LBD28_ARATH; LOB domain-containing protein 28
TrEMBLA0A078D1Y21e-133A0A078D1Y2_BRANA; BnaA01g21300D protein
STRINGBra030013.1-P1e-132(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50510.16e-52LOB domain-containing protein 28
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]